PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019505-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 483aa    MW: 51745.6 Da    PI: 5.9637
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019505-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-173178148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+++vk++G g+W+++ +  g+ R++k+c++rw ++l
    NNU_019505-RA 31 KGPWTAAEDAILIEYVKRHGEGNWNAVQKNSGLSRCGKSCRLRWANHL 78
                     79******************************************9986 PP

2Myb_DNA-binding47.44.4e-1584127146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E+ l+++++ +lG++ W++ a+ ++ gRt++++k++w++
    NNU_019505-RA  84 KGSFSPDEERLILELHSKLGNK-WARMAAQLP-GRTDNEIKNYWNT 127
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2562678IPR017930Myb domain
SuperFamilySSF466892.06E-3028125IPR009057Homeodomain-like
SMARTSM007171.3E-153080IPR001005SANT/Myb domain
PfamPF002491.3E-153178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-233285IPR009057Homeodomain-like
CDDcd001678.18E-123378No hitNo description
PROSITE patternPS0017504655IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129424.88679133IPR017930Myb domain
SMARTSM007172.2E-1583131IPR001005SANT/Myb domain
PfamPF002492.2E-1484127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2486132IPR009057Homeodomain-like
CDDcd001675.68E-1186127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MSNNNNNNNG AAAATTEDTS TGSGAGGGLK KGPWTAAEDA ILIEYVKRHG EGNWNAVQKN  60
SGLSRCGKSC RLRWANHLRP NLKKGSFSPD EERLILELHS KLGNKWARMA AQLPGRTDNE  120
IKNYWNTRVK RRQRAGLPLY PQDIQKRATA CNLNQHHQPH LSPSPPPPVQ LSMTQQPKQN  180
YGSPLSLFDS VNIPMTTPLI AQHSAPLLPT PIHRFKQLRD NNNAGFSFSS SPPTPLPPSS  240
SLFGESLSTQ LPPIPSLQFN SGHFDLNPPT ILQTPFEPDG ITPSGSAFST KMELPSSQLP  300
QPAATAAASG TTNDYKIPPL ARSNSGLLDA LLQEAQTMAA CDEDSRREGL SGDKCGLNGL  360
LGNALPSGLV FSELGSVSQW DESNSAHSSI GAKTKTEPIN EINSVLDDDL SGLLDIIPST  420
MSVPEWHSDS GEISNGQSSG LTDDDIGLEM QQLASSLSTA SATTTDPDWT LGSCSWNNMP  480
GIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32291325107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276128.10.0PREDICTED: myb-related protein B-like
TrEMBLF6HEP41e-121F6HEP4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0090g00590.t011e-121(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.29e-72myb domain protein 101